ELISA Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4(TNFSF4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Oryctolagus cunicµLus (Rabbit) Uniprot NO.:O02765 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGVRPLEENVGNAPRPRFERNKLLLVASVVQALGLLLCLTYVCQHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP Protein Names:Recommended name: Tumor necrosis factor ligand superfamily member 4 Alternative name(s): OX40 ligand Short name= OX40L CD_antigen= CD252 Gene Names:Name:TNFSF4 Synonyms:TXGP1 Expression Region:1-187 Sequence Info:fµLl length protein