ELISA Recombinant Rat Mitochondrial uncoupling protein 2(Ucp2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P56500 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLARTAASAQYR GVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRL LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTS PNVARNAIVNCTELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT RYMNSALGQYHSAGHCALTmLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA AYESREAPF Protein Names:Recommended name: Mitochondrial uncoupling protein 2 Short name= UCP 2 Alternative name(s): Solute carrier family 25 member 8 Gene Names:Name:Ucp2 Synonyms:Slc25a8 Expression Region:1-309 Sequence Info:FµLl length protein