ELISA Recombinant Rat Cytochrome b-c1 complex subunit Rieske, mitochondrial(Uqcrfs1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P20788 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SHTDIKVPDFSDYRRAEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNAVSQFVS SMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDP QHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNL EVPTYEFTSGDVVVVG Protein Names:Recommended name: Cytochrome b-c1 complex subunit Rieske, mitochondrial EC= 1.10.2.2 Alternative name(s): Complex III subunit 5 Cytochrome b-c1 complex subunit 5 Liver regeneration-related protein LRRGT00195 Rieske iron-sµLfur p Gene Names:Name:Uqcrfs1 Expression Region:79-274 Sequence Info:FµLl length protein