ELISA Recombinant Rat Vesicle-associated membrane protein 2(Vamp2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P63045 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST Protein Names:Recommended name: Vesicle-associated membrane protein 2 Short name= VAMP-2 Alternative name(s): Synaptobrevin-2 Gene Names:Name:Vamp2 Synonyms:Syb2 Expression Region:2-116 Sequence Info:fµLl length protein