ELISA Recombinant Xenopus laevis Vesicle-associated membrane protein 2(vamp2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:P47193 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SAPAAGPPAAAPGDGAPQGPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDTKLSELDDRADALQAGASQFETSAAKLKRKYWWKNMKMMIIMGVICAIILIIIIVYFST Protein Names:Recommended name: Vesicle-associated membrane protein 2 Short name= VAMP-2 Alternative name(s): SYBII Synaptobrevin-2 Gene Names:Name:vamp2 Expression Region:2-114 Sequence Info:fµLl length protein