ELISA Recombinant Rat Vesicle-associated membrane protein 3(Vamp3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P63025 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGISVLVIIVIIIIVWCVS Protein Names:Recommended name: Vesicle-associated membrane protein 3 Short name= VAMP-3 Alternative name(s): Cellubrevin Short name= CEB Synaptobrevin-3 Gene Names:Name:Vamp3 Synonyms:Syb3 Expression Region:1-103 Sequence Info:fµLl length protein