ELISA Recombinant Pyrenophora tritici-repentis Vacuolar ATPase assembly integral membrane protein VMA21(vma21)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis) Uniprot NO.:B2WDD8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTRRIVTSEKSTLDYDGKGAPEPSNTSPAVPSSVIWKLMSFTFAMITLPIGTYFFTVNW VFQGNATYAGGLAALMANVVLIAYVIMAFRDDQEEMREEAEKSKKKL Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21 Gene Names:Name:vma21 ORF Names:PTRG_07997 Expression Region:1-107 Sequence Info:fµLl length protein