ELISA Recombinant Vanderwaltozyma polyspora Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus) Uniprot NO.:A7TSA7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPVDVAPGVIKKLMFFTAAMVICPLLTFFSIKQFTTNTIVSGGLAALAANLVLIGYIVVAFMEDTTDVKAESKKD Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21 Gene Names:Name:VMA21 ORF Names:Kpol_359p4 Expression Region:1-75 Sequence Info:fµLl length protein