ELISA Recombinant Staphylococcus aureus Enterotoxin type I(SEI)

Quantity: 10µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 15-20 working days Research Topic: Others Uniprot ID: O85383 Gene Names: SEI Organism: Staphylococcus aureus AA Sequence: MKKFKYSFILVFILLFNIKDLTYAQGDIGVGNLRNFYTKHDYIDLKGVTDKNLPIANQLEFSTGTNDLISESNNWDEISKFKGKKLDIFGIDYNGPCKSKYMYGGATLSGQYLNSARKIPINLWVNGKHKTISTDKIATNKKLVTAQEIDVKLRRYLQEEYNIYGHNNTGKGKEYGYKSKFYSGFNNGKVLFHLNNEKSFSYDLFYTGDGLPVSFLKIYEDNKIIESEKFHLDVEISYVDSN Expression Region: 1-242aa Sequence Info: FµLl Length Source: in vitro E.coli expression system Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged MW: 47.9 kDa Alternative Name(s): sei Relevance: Reference: "PCR detection of staphylococcal enterotoxin genes in Staphylococcus spp. strains isolated from meat and dairy products. Evidence for new variants of seG and seI in S. aureus AB-8802." Blaiotta G., Ercolini D., Pennacchia C., Fusco V., Casaburi A., Pepe O., Villani F. J. Appl. Microbiol. 97:719-730(2004) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.