ELISA Recombinant Rat Olfactory receptor 1(Olfr1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:P70526 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTERNQTVISQFLLLGLPIPPEHQHVFYALFLSMYLTTVLGNLIIIILILLDSHLHTPMY LFLSNLSFSDLCFSSVTMPKLLQNMQSQVPSIPYAGCLSQIYFFLFFGDLGNFLLVAMAY DRYVAICFPLHYMSIMSPKLCVSLVVLSWVLTTFHAmLHTLLMARLSFCEDNVIPHFFCD MSALLKLACSDTRVNEVVIFIVVSLFLVLPFALIIMSYVRIVSSILKVPSSQGIYKAFST CGSHLSVVSLFYGTVIGLYLCPSSNNSTVKETVMSLMYTVVTPmLNPFIYSLRNRDIKGA MERIFCKRKIQLNL Protein Names:Recommended name: Olfactory receptor 1 Alternative name(s): Olfactory receptor 1469 Olfactory receptor HGL-SP1 Olfactory receptor OR5 Olfactory receptor-like protein I54 Gene Names:Name:Olfr1 Synonyms:Olr1469 Expression Region:1-314 Sequence Info:fµLl length protein