ELISA Recombinant Vaccinia virus Viral replication protein A28 (VACWR151)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) Uniprot NO.:P68633 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNSLSIFFIVVATAAVCLLFIQGYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMQQCIDFTFSDVININIYNPCVVPNINNAECQFLKSVL Protein Names:Recommended name: Viral replication protein A28 Gene Names:Ordered Locus Names:VACWR151 ORF Names:A28L Expression Region:1-146 Sequence Info:fµLl length protein