ELISA Recombinant Shigella phage SfII Bactoprenol glucosyl transferase(gtrB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Shigella phage SfII (Shigella flexneri bacteriophage II) (Bacteriophage SfII) Uniprot NO.:P68668 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKISLVVPVFNEEEAIPVFYKTVREFQELKPYEVEIVFINDGSKDATESIINALAVSDPL VVPLSFTRNFGKEPALFAGLDHASGDAVIPIDVDLQDPIEVIPHLIEKWQAGADMVLAKR SDRSTDGRLKRKTAEWFYKLHNKISTPKIEENVGDFRLMSREVVENIKLLPERNLFMKGI LSWVGGQTDVVEYVRAERVAGISKFNGWKLWNLALEGITSFSTFPLRVWTYIGLFVASIS FLYGAWMIIDTLVFGNPVRGYPSLLVSILFLGGVQLIGIGVLGEYIGRIYIEVKNRPKYI IKKSHRGNP Protein Names:Recommended name: Bactoprenol glucosyl transferase EC= 2.4.1.- Gene Names:Name:gtrB Synonyms:bgt Expression Region:1-309 Sequence Info:fµLl length protein