ELISA Recombinant Potato virus X Movement protein TGBp3 (ORF4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Potato virus X (strain Xc) (PVX) Uniprot NO.:P68833 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEAGAYLNAIIFVLVATIIAVISRGLTRTEPCTIRITGESITVHACHIDSETIKALANLKPLSLERLSFQ Protein Names:Recommended name: Movement protein TGBp3 Alternative name(s): 7 kDa protein Triple gene block 3 protein Short name= TGBp3 Gene Names:ORF Names:ORF4 Expression Region:1-70 Sequence Info:fµLl length protein