ELISA Recombinant Synechocystis sp. Uncharacterized membrane protein sll0875 (sll0875)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Synechocystis sp. (strain PCC 6803 / Kazusa) Uniprot NO.:P73555 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDNSLLSEIWRQSLAFPWLSAVILNSFLLALAAIAPKKLLTPWGYGHAWVLGVIIWAALG WRGYLVVLAYFFVGSAVTRIGQKEKEAAGIAEKRSGQRGPENVWGSALTAALCALAIAFG PEPWQLWLALGYVASFSTKLSDTTASEVGKAYGKNTFLITTLQPVPRGTEGAVSVEGTLA GFAAGLALAVLGYGVGLISFGGIIFSTLAAFIATNLESVIGATLQNKWPWLTNEVVNGIN TFLGAAIAIGIEATAQLI Protein Names:Recommended name: Uncharacterized membrane protein sll0875 Gene Names:Ordered Locus Names:sll0875 Expression Region:1-258 Sequence Info:fµLl length protein