Skip to Content

ELISA Recombinant Porcine respiratory coronavirus Envelope small membrane protein(E)

https://www.anagnostics.com/web/image/product.template/150330/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Porcine respiratory coronavirus (strain 86/137004 / isolate British) (PRCoV) (PRCV) Uniprot NO.:P69611 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTFPRALTVIDDNGMVISIIFWFLLIIILILLSIALLNIIKLCMVCCNLGRTVIIVPVQH AYDAYKNFMRIKAYNPDGALLV Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein Alternative name(s): ORF 3 Protein 4 Protein X1 Gene Names:Name:E Synonyms:NS4 Expression Region:1-82 Sequence Info:fµLl length protein

1,422.00 € 1422.0 EUR 1,422.00 €

1,422.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.