Skip to Content

ELISA Recombinant Rhizobium meliloti Sensor protein ChvG(chvG)

https://www.anagnostics.com/web/image/product.template/153527/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:P72292 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRGQRRWAHPFTLIRRLFGNAVFSSLTRRIVFFNLVALVVLVGGIMYLNQFREGLIDARV ESLLTQGEIIAGAISASASVDTNSITIDPEKLLELQAGESITPLPSDEDLEFPIIQERVA PVLRRLISPTRTRARLFDADADLLLDSRHLYSGGQVLRFDLPPVDPESPSLADEFGTWFN RLLQPGDLPLYKEPPGGNGSIYPEVMNALTGVRGAVVRVTEKGELIVSVAVPVQRFRAVL GVLLLSTQAGDIDKIVHAERLAIIRVFGVAALVNVILSLLLSSTIANPLRRLSAAAIRVR RGGAKEREEIPDFSSRQDEIGNLSVALREMTTALYDRIAAIENFAADVSHELKNPLTSLR SAVETLPLARNEESKKRLMDVIQHDVRRLDRLISDISDASRLDAELARADAKKVDLEKLL GDLVEISRQIRGSKKPVLLDFVVDRKDNPRASFIVSGYELRIGQIITNLIENARSFVPEQ NGRIVVRLTRSRLRCIVYVEDNGPGIQAEDIDRIFERFYTDRPEGEDFGQNSGLGLSISR QIAEAHGGTLRAENIAGKDGRISGARFVLSLPAGPHP Protein Names:Recommended name: Sensor protein ChvG EC= 2.7.13.3 Alternative name(s): Histidine kinase sensory protein ExoS Gene Names:Name:chvG Synonyms:exoS Ordered Locus Names:R00043 ORF Names:SMc04446 Expression Region:1-577 Sequence Info:fµLl length protein

1,944.00 € 1944.0 EUR 1,944.00 €

1,944.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.