ELISA Recombinant Synechocystis sp. UPF0093 membrane protein slr1790 (slr1790)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Synechocystis sp. (strain PCC 6803 / Kazusa) Uniprot NO.:P72793 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPKREYFSLPCPLSTFTMAYYWFKAFHLIGIVVWFAGLFYLVRLFVYHAEADQEPEPAKT ILKKQYELMEKRLYNIITTPGMVVTVAMAIGLIFTEPEILKSGWLHIKLTFVALLLLYHF YCGRVMKKLAQGESQWSGQQFRALNEAPTILLVVIVLLAVFKNNLPLDATTWLIVALVIA MAASIQLYAKKRRRDQALLTEQQKAASAQN Protein Names:Recommended name: UPF0093 membrane protein slr1790 Gene Names:Ordered Locus Names:slr1790 Expression Region:1-210 Sequence Info:fµLl length protein