ELISA Recombinant Rubrivivax gelatinosus Light-harvesting protein B-800-850 alpha chain(pucA)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rubrivivax gelatinosus (Rhodocyclus gelatinosus) (Rhodopseudomonas gelatinosa)
Uniprot NO.:P77799
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNQGKVWRVVKPTVGVPVYLGAVAVTALILHGGLLAKTDWFGAYWNGGKKAAAAAAAVAP APVAAPQAPAQ
Protein Names:Recommended name: Light-harvesting protein B-800/850 alpha chain Alternative name(s): Antenna pigment protein alpha chain LH2 alpha polypeptide
Gene Names:Name:pucA
Expression Region:1-71
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.