ELISA Recombinant Triticum timopheevii ATP synthase protein MI25
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Triticum timopheevii (Timopheev's wheat) (Triticum dicoccon var. timopheevii)
Uniprot NO.:P68537
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRFLSTDMKDRNmLFAAIPSICASSPKKISIYNEEMIVARCFIGFLIFSRKSLGKTFKET LDGRIESIQEELLQFFNPNEVIPEESNEQQRLLRISLRICSTVVESLPTARCAPKCEKTV QALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVSGSTFKASTIDLIREGL IVLRKVRVGGSI
Protein Names:Recommended name: ATP synthase protein MI25 Alternative name(s): ORF25
Gene Names:
Expression Region:1-192
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.