ELISA Recombinant Rhizobium meliloti Octopine transport system permease protein occQ(occQ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) Uniprot NO.:P72295 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGYLQLMGFGPDGWGSDmLRATGMTVAVASSAFTIGLVFGCLGATASFSKSLALQAAASS YTTALRGIPDLLVIYLFYFGSSSLISGVGSLFGSDGFVSAPAFLTGALAIGLVSAAYQTQ VLRGAVLALNKGEIEAGRAYGMGYFLLFRRIILPQAARHALPGVGNVWQLVLKESALISV IGLVELMRQAQVGSGSTRQPFSFYLTAAALYLLITFISGQAFRLAEARSMRGLRRGV Protein Names:Recommended name: Octopine transport system permease protein occQ Gene Names:Name:occQ Expression Region:1-237 Sequence Info:fµLl length protein