ELISA Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1155.2 (MJ1155.2)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Uniprot NO.:P81317
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MILDKTLFSSLTFSLTVLFLLLLIPNLKGFGKLSAIIGGFIALIFQYFGYPSLGILFAGI LSPIIILKIKSVK
Protein Names:Recommended name: Uncharacterized protein MJ1155.2
Gene Names:Ordered Locus Names:MJ1155.2
Expression Region:1-73
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.