ELISA Recombinant Schizosaccharomyces pombe RING finger protein mug145(mug145)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:P87119 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPIPKNRPMHVEEEVSSQTNTEILLFALVIILSVIFINFFFFYLCRCCVYFYHTLENQEG DDERPLIQHHMVNRSTGSLSPSVDRLGNVLGYDIPSRRRRSVVSKEALSCISLEIPYIKW LKKRKGHAKGESTFLDNRSENQSVIVQGQGETPSVIITYDVRRPNLGSTSFVEMSSALSN IYNTDASDGDSSDDSCLLEDEEDFCIICYADYAFDDILRVLPCEHVFHTQCIDTWMTTMK ASCPLCNEDYYKYFLQMDAASSVTHENAAWSIPLSPGDSRTHSAETDRSLLSAMSVRNSR MPYIVSSTL Protein Names:Recommended name: RING finger protein mµg145 Alternative name(s): Meiotic expression up-regµLated protein 34 Meiotically up-regµLated gene 145 protein Gene Names:Name:mµg145 Synonyms:meu34 ORF Names:SPAC3A12.03c Expression Region:1-309 Sequence Info:fµLl length protein