ELISA Recombinant Schistosoma japonicum 25 kDa integral membrane protein

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schistosoma japonicum (Blood fluke) Uniprot NO.:P91799 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKLSFTKVSLTNILILFNCLFIIFSMIVLTFGVIPQIYLLKFANILHGVRPSIFPIVCFT GSFVIIVACVGIIGLMKGGKCLLTMHIIALIIATIIDISTATLSAIKQNEFLTKAGQVLN DSSKLYYKNRLYATEFDLMHITFKCCNVKNDYSLLGTLHLIPESCTHGIEFYKQQCNEPL NKYVRYYIDILIYLCFIFGFIKLIYSLFTFTQRQRIFSEKTPVA Protein Names:Recommended name: 25 kDa integral membrane protein Alternative name(s): Sj25 Sj25/TM4 Gene Names: Expression Region:1-224 Sequence Info:fµLl length protein