ELISA Recombinant Ralstonia metallidurans Cobalt-zinc-cadmium resistance protein CzcN(czcN)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) Uniprot NO.:P94139 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTDSSISPSHPAGLSRALDNFLTRHRIGVWRVVVTFVLASLLFGHSRWDGTWVSPLLLTL GmLGVSLATVGRLWCALYISGRKNNTLVTSGPYSLCRHPLYVCNLLGILGLGAMTESLAV TAVLALAFALMYPAVIRTEDRFLASAFPEFAEYARRTPAFFPRLSLYRGESTWTVHVSSF QRNIADSVWFLGLSVVVESFDLFHDAGVLRAVVTLA Protein Names:Recommended name: Cobalt-zinc-cadmium resistance protein CzcN Alternative name(s): Cation efflux system protein CzcN Gene Names:Name:czcN Ordered Locus Names:Rmet_5984 Expression Region:1-216 Sequence Info:fµLl length protein