ELISA Recombinant Schizosaccharomyces pombe Protein GMH1 homolog(mug16)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:P87155 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSRSFRNGFRLLKLSQMDFERAWWDMANLFRAPRRVYRSITLRKQNINRYGREDFSFIVL FSCMIVISALLWALFYMNTPKGYVTTITFmLFVDFGAVGVIMATMYYFIAKRFLMKSNDT ILSSTDYQLEWNYCFDVHCNSFFPSFVLLYVIQLFLLPVITRDNFISLFMGNTLYLVALC YYSYLTFIGYQILPFLKNTHALLLPIPMFFIMWALSLLGFNVPKHVVDVYFGKSA Protein Names:Recommended name: Protein GMH1 homolog Alternative name(s): Meiotically up-regµLated gene 16 protein Gene Names:Name:mµg16 ORF Names:SPBC25H2.14 Expression Region:1-235 Sequence Info:fµLl length protein