ELISA Recombinant Schizosaccharomyces pombe Cell wall integrity and stress response component 1(wsc1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:P87179 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DMNTQYGCYLVDSSLTEQGTFTYLDPAYCYNNICGGSDNIAFVAIRNNQCYCGSTLTATE VSSSLCTTPCPGYGSLMCGGDLYWSVYLTGNGVLQTTVSSSSVSSTTSSSSSSSPSSSST TTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSVP ITSSTSSSHSSSSSSSSSSSSSSRPSSSSSFITTMSSSTFISTVTVTPSSSSSSTSSEVP SSTAALALNASKASNHTSLNAGAIVGIVIGCVAFAVVMALCIFLYFYFRRFKIRMSDSAN EGKYPSYASELDSRLDPAMMNRKSSESLADSQDYSRKILRVTNLN Protein Names:Recommended name: Cell wall integrity and stress response component 1 Gene Names:Name:wsc1 ORF Names:SPBC30B4.01c, SPBC3D6.14c Expression Region:30-374 Sequence Info:fµLl length protein