ELISA Recombinant Pseudomonas aeruginosa UPF0060 membrane protein PA14_21660 (PA14_21660)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas aerµginosa (strain UCBPP-PA14) Uniprot NO.:Q02QA7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MINYLWFVLAAFCEIAGCYAFYLWLRLGKSALWVLPGLLSLTLFALLLTRVEASYAGRAY AAYGGIYVAASLFWLAFVERSRPLWSDWLGVALCVVGASVVLFGPRLSQ Protein Names:Recommended name: UPF0060 membrane protein PA14_21660 Gene Names:Ordered Locus Names:PA14_21660 Expression Region:1-109 Sequence Info:fµLl length protein