ELISA Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4(GP4)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Porcine reproductive and respiratory syndrome virus (strain Lelystad) (PRRSV) Uniprot NO.:Q04568 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CKPCFSTHLSDIETNTTAAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGTPQY ITITANVTDESYLYNADLLmLSACLFYASEMSEKGFKVIFGNVSGVVSACVNFTDYVAHV TQHTQQHHLVIDHIRLLHFLTPSAMRWATTIACLFAILLAI Protein Names:Recommended name: Glycoprotein 4 Short name= Protein GP4 Gene Names:Name:GP4 ORF Names:4 Expression Region:23-183 Sequence Info:fµLl length protein