ELISA Recombinant Saccharomyces cerevisiae pH-response regulator protein palI-RIM9(RIM9)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q04734 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSMIHIVVFLLAITTMFEILPLITVPVTKYLSLSSFRNHYYGLFGWCVRGQNQELMCTK MKIGYDSTDVDSSGHVLTLPSNSKVVVSNLLVVHPISLAFTGTLLILAVIIMVTPLGDSP EmLLFTALFSLPTFmLCLLCFLVDILLFISKLDWPGWLmLAATISVALCCSmLWVMRRVV SVKKYESQQSIAHACSMEQYSISDIYQSKQNGNSSEYEVAPTHTDSLIAPEVTYRGFIE Protein Names:Recommended name: pH-response regµLator protein palI/RIM9 Alternative name(s): RegµLator of IME2 protein 9 Gene Names:Name:RIM9 Ordered Locus Names:YMR063W ORF Names:YM9916.02 Expression Region:1-239 Sequence Info:fµLl length protein