ELISA Recombinant Streptococcus pneumoniae serotype 2 UPF0397 protein SPD_0432 (SPD_0432)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) Uniprot NO.:Q04M08 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEIKFTIKQVVAVGIGAALFVVIGMINIPTPVPNTSIQLQYAVQALLSIIFGPIIGLLVG LIGHAIKDSLVGYGLWWTWIIASGLFGLVVGLFRKYVRVINGVFDWKDILIFNLIQLLAN ALVWGVLAPLGDVVIYQEAAEKVFAQGIVAGIANGVSVAIAGTLLLLAYAGTQTRAGSLK KD Protein Names:Recommended name: UPF0397 protein SPD_0432 Gene Names:Ordered Locus Names:SPD_0432 Expression Region:1-182 Sequence Info:fµLl length protein