ELISA Recombinant Zea mays Chlorophyll a-b binding protein 48, chloroplastic(CAB48)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Zea mays (Maize) Uniprot NO.:Q00827 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:RKTAAKPKPARSGSPWYGADRVLYLGPLSGSPPSYLTGEFPGDYGWDTEGLSADPETFAK NRELEVIHCRWAIAVGLGCVFPELLARNGVKFGEGVWFKAGSQIFSEGGLSHPGNPSLVH AQSILAIWACQVVLMGAVEGYHVAGGRLGEVVDPLYLGGSFDPLGLGDDPERFAELKVKE IKNGRLAMFSMFGFFVQAIVTGKGPIENLADHLTDPVNNNAWAYATNFVPGK Protein Names:Recommended name: Chlorophyll a-b binding protein 48, chloroplastic Alternative name(s): LHCII type I CAB-48 Short name= LHCP Gene Names:Name:CAB48 Expression Region:33-264 Sequence Info:fµLl length protein