Skip to Content

ELISA Recombinant Saccharomyces cerevisiae Sensitive to high expression protein 9, mitochondrial(SHE9)

https://www.anagnostics.com/web/image/product.template/154813/image_1920?unique=9b59aed
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:Q04172 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:FHYSSYSLQNGDTPDKGSTNKNEIRTPNNAVWKENIELQWQHLKKKLNELYSRFNFHRDQ LSFQVNKAKKSIQEANRKLSEQENEINDSRLNYNKDELTSAKIEGLPSEREQHRKKWSRK LEFYFDSLQETLFTATRALNDVTGYSGIQKLKSSISLMEKKLEATKKEHKLFKAQYANAI DERAQSQREVNELLQRQSAWSSSDLERFTQLYKNDALNARQEQELKNKVKEIESKEEQLN DDLYRAILTRYHEEQIWSDKIRRTSTWGTFILMGMNIFLFIVLQLLLEPWKRKRLVGSFE DKVKSALNEYAKEQNMKMDKLLPGKSSEVTDQGNTENSIVEEHIEQRGECKINTAEIDRP EVATAETTTTEMKSFRDIWERIKALFVTLKSIQYRKLDAPLVFDTLEFYLYSISLVSMTI LVSGLI Protein Names:Recommended name: Sensitive to high expression protein 9, mitochondrial Alternative name(s): Mitochondrial distribution and morphology protein 33 Gene Names:Name:SHE9 Synonyms:MDM33 Ordered Locus Names:YDR393W ORF Names:D9509.13 Expression Region:31-456 Sequence Info:fµLl length protein

1,785.00 € 1785.0 EUR 1,785.00 €

1,785.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.