ELISA Recombinant Varicella-zoster virus Glycoprotein N(GN)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Varicella-zoster virus (strain Oka vaccine) (HHV-3) ( herpesvirus 3)
Uniprot NO.:P0C764
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EPNFAERNFWHASCSARGVYIDGSMITTLFFYASLLGVCVALISLAYHACFRLFTRSVLR STW
Protein Names:Recommended name: Glycoprotein N Short name= gN
Gene Names:Name:GN ORF Names:9A
Expression Region:25-87
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.