ELISA Recombinant Saccharomyces cerevisiae Putative uncharacterized YKL165C-A (YKL165C-A)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P0C5P5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQFPVFFFRCFSYGISSMPLKNKVVFNENMERKDTFYQLILKVLSALLLLSVRNSSGHTR HFVQSSEKIYRRSLFKQ
Protein Names:Recommended name: Putative uncharacterized YKL165C-A
Gene Names:Ordered Locus Names:YKL165C-A
Expression Region:1-77
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.