ELISA Recombinant Porcine reproductive and respiratory syndrome virus Envelope small membrane protein(GP2b)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Porcine reproductive and respiratory syndrome virus (strain Lelystad) (PRRSV) Uniprot NO.:P0C6Y6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GSLWSKISQLFVDAFTEFLVSVVDIAIFLAILFGFTVAGWLLVFLLRVVCSALLRSRSAI HSPELSKVL Protein Names:Recommended name: Envelope small membrane protein Short name= Protein E Alternative name(s): Glycoprotein 2b Short name= Protein GP2b Gs Gene Names:Name:GP2b ORF Names:2b Expression Region:2-70 Sequence Info:fµLl length protein