ELISA Recombinant Rhizopus oryzae FK506-binding protein 2A(FKBP2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rhizopus oryzae (Rhizopus delemar) Uniprot NO.:P0C1J4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AKSESTINKPEKCGLKASSSSTVRIHYRSRVWGQEEYFESTYIREAPLEVKLGNGNLLKG IEDGIHGMCTGEIRRLLIPPNQAYGAIGIPNLVPPNTAIVVDVEMVNVNSPFSLWFWISG LILFSAFLLFGRKPIKGDTSNIKKKE Protein Names:Recommended name: FK506-binding protein 2A EC= 5.2.1.8 Alternative name(s): Peptidyl-prolyl cis-trans isomerase Short name= PPIase Rotamase Gene Names:Name:FKBP2 Synonyms:fpr2 ORF Names:RO3G_06709 Expression Region:22-167 Sequence Info:fµLl length protein