ELISA Recombinant Rhizopus oryzae FK506-binding protein 2B(FKBP3)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rhizopus oryzae (Rhizopus delemar)
Uniprot NO.:P0C1J5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LKEPPTQLQVGVKKRIPASECTRKSHSGDELSMHYTGTLFDTGEKFDSSLDRNEPFVFTL GAGQVIQGWDQGLLGMCVGEKRRLVIPPHLGYGERGAGGVIPGGATLVFEVELLEIKPGK YNQKAMPVQQQQESPISFTSPSFLVSTGIIVALFLIVFKMAKKQDIAEANEKAAAATAEA STEKKEEKKE
Protein Names:Recommended name: FK506-binding protein 2B EC= 5.2.1.8 Alternative name(s): Peptidyl-prolyl cis-trans isomerase Short name= PPIase Rotamase
Gene Names:Name:FKBP3 Synonyms:fpr3 ORF Names:RO3G_11675
Expression Region:20-209
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.