ELISA Recombinant Saccharomyces cerevisiae Uncharacterized protein YPR170W-B (YPR170W-B)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P0C5R9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRPVVSTGKAWCCTVLSAFGVVILSVIAHLFNTNHESFVGSINDPEDGPAVAHTVYLAAL VYLVFFVFCGFQVYLARRKPSIELR Protein Names:Recommended name: Uncharacterized protein YPR170W-B Gene Names:Ordered Locus Names:YPR170W-B Expression Region:1-85 Sequence Info:fµLl length protein