ELISA Recombinant Vibrio cholerae serotype O1 Type 4 prepilin-like proteins leader peptide-processing enzyme(tcpJ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Uniprot NO.:P0C6D9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEYVYLILFSIVSLILGSFSNVVIYRLPRKILLKNHFFYDIDSNRSMCPKCGNKISWYDN VPLLSYLLLHGKCRHCDEKISLSYFIVELSFFIIAFPIYWLSTDWVDSFVLLGLYFILFN LFVIDFKSmLLPNLLTYPIFmLAFIYVQQNPALTVESSIIGGFAAFIISYVSNFIVRLFK RIDVMGGGDIKLYTAIGTLIGVEFVPYLFLLSSIIAFIHWFFARVSCRYCLYIPLGPSII ISFVIVFFSIRLM Protein Names:Recommended name: Type 4 prepilin-like proteins leader peptide-processing enzyme Including the following 2 domains: Leader peptidase EC= 3.4.23.43 Alternative name(s): Prepilin peptidase N-methyltransferase EC= 2.1.1.- Gene Names:Name:tcpJ Ordered Locus Names:VC_0839 Expression Region:1-253 Sequence Info:fµLl length protein