ELISA Recombinant Potato virus X Movement protein TGB2 (ORF3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Potato virus X (strain X3) (PVX) Uniprot NO.:P0C786 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAQGHRLTAPVNSEKVYIVLGLSFALVSITFLLSRNSLPHVGDNIHSLPHGGAYRDGTK AILYNSPNLGSRVSLHNGKNAAFAAVLLLTLLIYGSKYISQRNHTCACGNNHSSH Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): 12 kDa protein Triple gene block 2 protein Short name= TGBp2 Gene Names:ORF Names:ORF3 Expression Region:1-115 Sequence Info:fµLl length protein