ELISA Recombinant Salmonella typhimurium Spermidine-putrescine transport system permease protein PotB(potB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) Uniprot NO.:P0CL49 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNTSKFQNVVIVTIVGWLVLFVFLPNLMIIGTSFLTRDDASFVKMVFTLDNYARLLDPL YFEVLLHSLNMALIATLSCLVLGYPFAWFLAKLPEKIRPLLLFLLIVPFWTNSLIRIYGL KIFLSTKGYLNEFLLWLGVIDTPIRIMFTPSAVIIGLVYILLPFMVMPLYSSIEKLDKPL LEAARDLGASKMQTFIRIIIPLTMPGIVAGCLLVmLPAMGLFYVSDLMGGAKNLLIGNVI KVQFLNIRDWPFGAATSITLTIVMGLmLLIYWRASRLLNKKVSDISD Protein Names:Recommended name: Spermidine/putrescine transport system permease protein PotB Gene Names:Name:potB Ordered Locus Names:STM1225 Expression Region:1-287 Sequence Info:fµLl length protein