ELISA Recombinant Schizosaccharomyces pombe UPF0494 membrane protein CPT2R1.01c (SPBCPT2R1.01c, SPBPB2B2.20c)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) Uniprot NO.:P0CS87 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNPESLKKQVEPPGYNELFMVEDVCNVDLEQGLDLCKPEKVNKQSQRSRQSRQSLFTNT IKPQKDKMNIKTNKIKEFLNDLFTEFSKFHNSYYPDGRISTRSNFRWPLLIIWSIIIVFA VDKKFEVQKFLSIWINENRFYSEIWVPIAIYVCLLVLmLLSLIFFAEFAVLALRVTGVII AVLGMIIAVLGMIIAALGATITGLLYFGHWALYKLVILSLGFKIVTPGDVCVSNTLPTHN GETALHSETTVGSDIEQIELQNMPTPVKK Protein Names:Recommended name: UPF0494 membrane protein CPT2R1.01c Gene Names:ORF Names:SPBCPT2R1.01c, SPBPB2B2.20c Expression Region:1-269 Sequence Info:fµLl length protein