ELISA Recombinant Streptococcus pyogenes serotype M3 Uncharacterized membrane protein SPs1599 (SPs1599)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Streptococcus pyogenes serotype M3 (strain SSI-1) Uniprot NO.:P0DA11 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLmLYPFRENLISILVNQPMIYYG AAIIELILVFVASGAARKNTPAALPIFLIYAALNGFTLSFIIVAYAQTTVFQAFLSSAAV FFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISVLIFSGLI ASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLLRIFGRND Protein Names:Recommended name: Uncharacterized membrane protein SPs1599 Gene Names:Ordered Locus Names:SPs1599 Expression Region:1-229 Sequence Info:fµLl length protein