ELISA Recombinant Rhodobacter capsulatus Electron transport complex protein RnfA(rnfA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rhodobacter capsµLatus (Rhodopseudomonas capsµLata) Uniprot NO.:P0CZ13 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQDFLLVLLSTALVNNVVLVKFLGLCPFMGVSRKTDAAIGMGLATTFVITVASAACWLVE ALILEPLDLKFLRILSMILVIAAIVQFIETVMRKVTPDLHKALGIYLPLITTNCAVLGLP LMYIQGHLSLAMSTLSGFGASVGFTLVLVIFAGMRERLAQLSVPAAFAGTPIAFVSAGLL GLAFMGFAGLVHV Protein Names:Recommended name: Electron transport complex protein RnfA Alternative name(s): Nitrogen fixation protein RnfA Gene Names:Name:rnfA Expression Region:1-193 Sequence Info:fµLl length protein