ELISA Recombinant Saccharomyces cerevisiae Mitochondrial RNA-splicing protein MRS3(MRS3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Uniprot NO.:P10566 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVENSSSNNSTRPIPAIPMDLPDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTR IQSANAKSLSAKNmLSQISHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYEFCKKNLI DSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQLNTSASVWQTTKQIYQSEGLA AFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEYNPLIHCLCGSISGSTCAAITTPL DCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAIS WTAYECAKHFLMTY Protein Names:Recommended name: Mitochondrial RNA-splicing protein MRS3 Gene Names:Name:MRS3 Ordered Locus Names:YJL133W ORF Names:J0675 Expression Region:1-314 Sequence Info:fµLl length protein