ELISA Recombinant Potato leafroll virus Protein P1 (ORF1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Potato leafroll virus (strain Potato/Netherlands/Wageningen/1989) (PLrV) Uniprot NO.:P11622 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:STAVKGRVFSDETVKELEREASEAVKKLARFKSLTGKNWANDYDSDEDYGLEKEAATNAP AEKTAQTNSAEKTAPSTSAEKTAPTNKPLNGRAAPPAKTNGNSDIPDAAISAPPMDKMVE QIITAMVGRINLSEIEEKIVSRVSQKALQKPKQNKRGRRGGKNKQNNLPPTSTQSISGAP KKKAVPQASGSAGISPATTTPAPKEKPSGGKNSAKFIPSWRIKQQDSAGQKPDLKLNSKA Protein Names:Recommended name: Protein P1 Alternative name(s): 69.7 kDa protein Genome-linked protein precursor Protein ORF1 Cleaved into the following 2 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg/P1-C25 Gene Names:ORF Names:ORF1 Expression Region:400-639 Sequence Info:fµLl length protein