Skip to Content

ELISA Recombinant Silene pratensis Chlorophyll a-b binding protein, chloroplastic

https://www.anagnostics.com/web/image/product.template/157429/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Silene pratensis (White campion) (Lychnis alba) Uniprot NO.:P12332 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:RRTIKSAPESIWYGPDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFAKNREL EVIHCRWAmLGALGCVFPELLAKNGVKFGEAVWFKAGSQIFQEGGLDYLGNPNLVHAQSI LAIWACQVVLMGAVEGYRVGGGPLGEGLDQLYPGGAFDPLGLAEDPEAF Protein Names:Recommended name: Chlorophyll a-b binding protein, chloroplastic Alternative name(s): LHCII type I CAB Short name= LHCP Gene Names: Expression Region:37-205 Sequence Info:fµLl length protein

1,513.00 € 1513.0 EUR 1,513.00 €

1,513.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.