ELISA Recombinant Raphanus sativus Chlorophyll a-b binding of LHCII type 1 protein

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Raphanus sativus (Radish) Uniprot NO.:P14584 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LDYLGNPSLVHAQSILAIWATQVILMGAVEGYRVAGDGPLGEAEDLLYPGGSFDPLASLT DPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNF VPGK Protein Names:Recommended name: Chlorophyll a-b binding of LHCII type 1 protein Alternative name(s): Chlorophyll a-b binding of LHCII type I protein Short name= CAB Short name= LHCP Gene Names: Expression Region:1-124 Sequence Info:fµLl length protein