Skip to Content

ELISA Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_448915 (SELMODRAFT_448915)

https://www.anagnostics.com/web/image/product.template/156652/image_1920?unique=263afdf
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Selaginella moellendorffii (Spikemoss) Uniprot NO.:P0DH63 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGVADAPSPGNVPVLGDMKNRSAAEMKISVLALRALTLVLLVIALALMVSNKQTQSIPIK LPGMASTIFLKKTATFSQITGVQYYVGALSVAVAYMFFQmLAGLFTILTTGSIVGSKSRA WVTFILDQLIAYLMVSAATVVAEVGYIARRGETKVGWNQVCSDFKHYCFIYGFSLVNAFL ATIAFLPVVAVSAFHLFRMYGAQSAQSK Protein Names:Recommended name: CASP-like protein SELMODRAFT_448915 Gene Names:ORF Names:SELMODRAFT_448915 Expression Region:1-208 Sequence Info:fµLl length protein

1,555.00 € 1555.0 EUR 1,555.00 €

1,555.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.