ELISA Recombinant Selaginella moellendorffii CASP-like protein SELMODRAFT_448915 (SELMODRAFT_448915)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Selaginella moellendorffii (Spikemoss)
Uniprot NO.:P0DH63
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MGVADAPSPGNVPVLGDMKNRSAAEMKISVLALRALTLVLLVIALALMVSNKQTQSIPIK LPGMASTIFLKKTATFSQITGVQYYVGALSVAVAYMFFQmLAGLFTILTTGSIVGSKSRA WVTFILDQLIAYLMVSAATVVAEVGYIARRGETKVGWNQVCSDFKHYCFIYGFSLVNAFL ATIAFLPVVAVSAFHLFRMYGAQSAQSK
Protein Names:Recommended name: CASP-like protein SELMODRAFT_448915
Gene Names:ORF Names:SELMODRAFT_448915
Expression Region:1-208
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.