ELISA Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 7, chloroplastic(CAB7)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Solanum lycopersicum (Tomato) (Lycopersicon escµLentum) Uniprot NO.:P10708 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SKYSTTPTARSATTVCVAADPDRPLWFPGSTPPPWLDGSLPGDFGFDPLGLASDPESLRW NQQAELVHCRWAmLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIG WAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKE IKNGRLAmLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFSPK Protein Names:Recommended name: Chlorophyll a-b binding protein 7, chloroplastic Alternative name(s): LHCI type II CAB-7 Gene Names:Name:CAB7 Expression Region:43-270 Sequence Info:fµLl length protein